Recombinant Human DLL1 protein, GST-tagged
| Cat.No. : | DLL1-301511H |
| Product Overview : | Recombinant Human DLL1 (568-715 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Cys568-Asp715 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | CVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DLL1 delta-like 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLL1 |
| Synonyms | DLL1; delta-like 1 (Drosophila); delta (Drosophila) like 1; delta-like protein 1; H-Delta-1; drosophila Delta homolog 1; DL1; Delta; DELTA1; |
| Gene ID | 28514 |
| mRNA Refseq | NM_005618 |
| Protein Refseq | NP_005609 |
| MIM | 606582 |
| UniProt ID | O00548 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL1 Products
Required fields are marked with *
My Review for All DLL1 Products
Required fields are marked with *
