Recombinant Human DOT1L Protein, GST-tagged

Cat.No. : DOT1L-2821H
Product Overview : Human DOT1L partial ORF ( NP_115871, 3 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.4 kDa
AA Sequence : EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ]
Official Symbol DOT1L
Synonyms DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823;
Gene ID 84444
mRNA Refseq NM_032482
Protein Refseq NP_115871
MIM 607375
UniProt ID Q8TEK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOT1L Products

Required fields are marked with *

My Review for All DOT1L Products

Required fields are marked with *

0
cart-icon
0
compare icon