Recombinant Human DOT1L Protein, GST-tagged
Cat.No. : | DOT1L-2821H |
Product Overview : | Human DOT1L partial ORF ( NP_115871, 3 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 37.4 kDa |
AA Sequence : | EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DOT1L |
Synonyms | DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823; |
Gene ID | 84444 |
mRNA Refseq | NM_032482 |
Protein Refseq | NP_115871 |
MIM | 607375 |
UniProt ID | Q8TEK3 |
◆ Recombinant Proteins | ||
DOT1L-120H | Recombinant Human DOT1 like histone lysine methyltransferase Protein, His&StrepII tagged | +Inquiry |
DOT1L-2979H | Recombinant Human DOT1L protein, His-tagged | +Inquiry |
DOT1L3226H | Recombinant Human Dot1L (1-416) Protein | +Inquiry |
DOT1L-27742TH | Recombinant Human DOT1L | +Inquiry |
DOT1L21203H | Recombinant Human Dot1L (1-351) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOT1L-6841HCL | Recombinant Human DOT1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOT1L Products
Required fields are marked with *
My Review for All DOT1L Products
Required fields are marked with *