Recombinant Human DOT1L Protein, GST-tagged
| Cat.No. : | DOT1L-2821H |
| Product Overview : | Human DOT1L partial ORF ( NP_115871, 3 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 37.4 kDa |
| AA Sequence : | EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DOT1L |
| Synonyms | DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823; |
| Gene ID | 84444 |
| mRNA Refseq | NM_032482 |
| Protein Refseq | NP_115871 |
| MIM | 607375 |
| UniProt ID | Q8TEK3 |
| ◆ Recombinant Proteins | ||
| DOT1L-2821H | Recombinant Human DOT1L Protein, GST-tagged | +Inquiry |
| DOT1L-767H | Recombinant Human DOT1L protein | +Inquiry |
| DOT1L-27742TH | Recombinant Human DOT1L | +Inquiry |
| DOT1L21203H | Recombinant Human Dot1L (1-351) Protein | +Inquiry |
| DOT1L-658H | Recombinant Human DOT1L, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DOT1L-6841HCL | Recombinant Human DOT1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOT1L Products
Required fields are marked with *
My Review for All DOT1L Products
Required fields are marked with *
