Recombinant Human DOT1L protein, His-tagged

• Cat.No.: DOT1L-2979H
• Product Overview: Recombinant Human DOT1L protein(511-698 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 511-698 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DOT1L
• Synonyms: DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823
• Gene ID: 84444
• mRNA Refseq: NM_032482
• Protein Refseq: NP_115871
• MIM: 607375
• UniProt ID: Q8TEK3