Recombinant Human DOT1L protein, His-tagged
Cat.No. : | DOT1L-2979H |
Product Overview : | Recombinant Human DOT1L protein(511-698 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 511-698 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DOT1L |
Synonyms | DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823; |
Gene ID | 84444 |
mRNA Refseq | NM_032482 |
Protein Refseq | NP_115871 |
MIM | 607375 |
UniProt ID | Q8TEK3 |
◆ Recombinant Proteins | ||
DOT1L-2821H | Recombinant Human DOT1L Protein, GST-tagged | +Inquiry |
DOT1L-180H | Active Recombinant Human DOT1L protein, GST-tagged | +Inquiry |
DOT1L-658H | Recombinant Human DOT1L, GST-tagged | +Inquiry |
DOT1L-2979H | Recombinant Human DOT1L protein, His-tagged | +Inquiry |
DOT1L21203H | Recombinant Human Dot1L (1-351) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOT1L-6841HCL | Recombinant Human DOT1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOT1L Products
Required fields are marked with *
My Review for All DOT1L Products
Required fields are marked with *
0
Inquiry Basket