Recombinant Human EEF1B2 Protein, GST-tagged
| Cat.No. : | EEF1B2-3069H |
| Product Overview : | Human EEF1B2 full-length ORF ( AAH00211, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 50.49 kDa |
| AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens ] |
| Official Symbol | EEF1B2 |
| Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
| Gene ID | 1933 |
| mRNA Refseq | NM_001037663 |
| Protein Refseq | NP_001032752 |
| MIM | 600655 |
| UniProt ID | P24534 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *



