"EIF3J" Related Products

Expand
Expand

Recombinant Human EIF3J Protein, GST-tagged

Cat.No. : EIF3J-3189H
Product Overview : Human EIF3S1 full-length ORF ( NP_003749.2, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chromosomes 1, 3, and 9. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 55.5 kDa
AA Sequence : MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : EIF3J eukaryotic translation initiation factor 3, subunit J [ Homo sapiens ]
Official Symbol : EIF3J
Synonyms : EIF3J; eukaryotic translation initiation factor 3, subunit J; EIF3S1, eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3 subunit J; eIF3 alpha; eIF3 p35; eIF3j; eIF-3-alpha; eukaryotic translation initiation factor 3 subunit 1; eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa; eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD); EIF3S1; eIF3-p35; eIF3-alpha;
Gene ID : 8669
mRNA Refseq : NM_003758
Protein Refseq : NP_003749
MIM : 603910
UniProt ID : O75822

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.