Recombinant Human EIF3L protein, His-tagged

• Cat.No.: EIF3L-3936H
• Product Overview: Recombinant Human EIF3L protein(255-564 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 255-564 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EIF3L eukaryotic translation initiation factor 3, subunit L [ Homo sapiens ]
• Official Symbol: EIF3L
• Synonyms: EIF3L; eukaryotic translation initiation factor 3, subunit L; EIF3EIP, EIF3S6IP, eukaryotic translation initiation factor 3, subunit 6 interacting protein , eukaryotic translation initiation factor 3, subunit E interacting protein; eukaryotic translation initiation factor 3 subunit L; EIF3S11; HSPC021; HSPC025; eIEF associated protein HSPC021; eukaryotic translation initiation factor 3 subunit 6-interacting protein; eukaryotic translation initiation factor 3 subunit E-interacting protein; EIF3EIP; MSTP005; EIF3S6IP
• Gene ID: 51386
• mRNA Refseq: NM_001242923
• Protein Refseq: NP_001229852
• UniProt ID: Q9Y262