Recombinant Human EMR4P Protein, GST-tagged

• Cat.No.: EMR4P-3294H
• Product Overview: Human EMR4 partial ORF ( XP_377506, 21 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008]
• Molecular Mass: 33.77 kDa
• AA Sequence: GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADGRE4P adhesion G protein-coupled receptor E4, pseudogene [ Homo sapiens (human) ]
• Official Symbol: EMR4P
• Synonyms: ADGRE4P; adhesion G protein-coupled receptor E4, pseudogene; Adhesion G Protein-Coupled Receptor E4, Pseudogene; Egf-Like Module Containing, Mucin-Like, Hormone Receptor-Like 4 Pseudogene; G Protein-Coupled Receptor 127; GPR127; EMR4P; PGR16; EMR4; Egf-Like Module Containing, Mucin-Like, Hormone Receptor-Like 4; EGF-Like Module-Containing Mucin-Like Hormone Receptor-Like 4; G-Protein Coupled Receptor PGR16; G-Protein Coupled Receptor 127; EGF-Like Module Receptor 4; EGF-TM7 Receptor EMR4; FIRE; EGF-TM7 receptor EMR4; G protein-coupled receptor 127; egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene
• Gene ID: 326342
• MIM: 612305
• UniProt ID: Q86SQ3