Recombinant Human ENOPH1, His-tagged
| Cat.No. : | ENOPH1-29130TH |
| Product Overview : | Recombinant full length Human MASA (amino acids 1-261) with an N terminal His tag; 281aa, Molecular Weight: 31kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 261 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 31.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST |
| Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. MasA/mtnC family. |
| Gene Name | ENOPH1 enolase-phosphatase 1 [ Homo sapiens ] |
| Official Symbol | ENOPH1 |
| Synonyms | ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA; |
| Gene ID | 58478 |
| mRNA Refseq | NM_021204 |
| Protein Refseq | NP_067027 |
| Uniprot ID | Q9UHY7 |
| Chromosome Location | 4q21.3 |
| Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem; |
| Function | 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity; 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity; acireductone synthase activity; acireductone synthase activity; hydrolase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENOPH1 Products
Required fields are marked with *
My Review for All ENOPH1 Products
Required fields are marked with *



