Recombinant Human ERMN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ERMN-1420H |
Product Overview : | ERMN MS Standard C13 and N15-labeled recombinant protein (NP_065762) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ERMN (Ermin) is a Protein Coding gene. Diseases associated with ERMN include Atrial Septal Defect 5 and Contagious Pustular Dermatitis. Gene Ontology (GO) annotations related to this gene include actin binding and actin filament binding. An important paralog of this gene is RDX. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ERMN ermin [ Homo sapiens (human) ] |
Official Symbol | ERMN |
Synonyms | ERMN; ermin, ERM-like protein; KIAA1189; ermin; ERMIN; JN; juxtanodin; |
Gene ID | 57471 |
mRNA Refseq | NM_020711 |
Protein Refseq | NP_065762 |
MIM | 610072 |
UniProt ID | Q8TAM6 |
◆ Recombinant Proteins | ||
ERMN-2855M | Recombinant Mouse ERMN Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMN-1420H | Recombinant Human ERMN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERMN-1798R | Recombinant Rat ERMN Protein, His (Fc)-Avi-tagged | +Inquiry |
ERMN-2141R | Recombinant Rat ERMN Protein | +Inquiry |
Ermn-2863M | Recombinant Mouse Ermn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERMN-6548HCL | Recombinant Human ERMN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERMN Products
Required fields are marked with *
My Review for All ERMN Products
Required fields are marked with *