Recombinant Human ERMN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ERMN-1420H
Product Overview : ERMN MS Standard C13 and N15-labeled recombinant protein (NP_065762) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ERMN (Ermin) is a Protein Coding gene. Diseases associated with ERMN include Atrial Septal Defect 5 and Contagious Pustular Dermatitis. Gene Ontology (GO) annotations related to this gene include actin binding and actin filament binding. An important paralog of this gene is RDX.
Molecular Mass : 32.8 kDa
AA Sequence : MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ERMN ermin [ Homo sapiens (human) ]
Official Symbol ERMN
Synonyms ERMN; ermin, ERM-like protein; KIAA1189; ermin; ERMIN; JN; juxtanodin;
Gene ID 57471
mRNA Refseq NM_020711
Protein Refseq NP_065762
MIM 610072
UniProt ID Q8TAM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERMN Products

Required fields are marked with *

My Review for All ERMN Products

Required fields are marked with *

0
cart-icon
0
compare icon