Recombinant Human ERMN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ERMN-1420H
• Product Overview: ERMN MS Standard C13 and N15-labeled recombinant protein (NP_065762) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ERMN (Ermin) is a Protein Coding gene. Diseases associated with ERMN include Atrial Septal Defect 5 and Contagious Pustular Dermatitis. Gene Ontology (GO) annotations related to this gene include actin binding and actin filament binding. An important paralog of this gene is RDX.
• Molecular Mass: 32.8 kDa
• AA Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ERMN ermin [ Homo sapiens (human) ]
• Official Symbol: ERMN
• Synonyms: ERMN; ermin, ERM-like protein; KIAA1189; ermin; ERMIN; JN; juxtanodin
• Gene ID: 57471
• mRNA Refseq: NM_020711
• Protein Refseq: NP_065762
• MIM: 610072
• UniProt ID: Q8TAM6