Recombinant Human ESRRG protein, GST-tagged
Cat.No. : | ESRRG-301595H |
Product Overview : | Recombinant Human ESRRG (94-442 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu94-Val442 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ESRRG estrogen-related receptor gamma [ Homo sapiens ] |
Official Symbol | ESRRG |
Synonyms | ESRRG; estrogen-related receptor gamma; ERR gamma-2; estrogen receptor-related protein 3; nuclear receptor subfamily 3 group B member 3; ERR3; NR3B3; ERRgamma; FLJ16023; KIAA0832; DKFZp781L1617; |
Gene ID | 2104 |
mRNA Refseq | NM_001134285 |
Protein Refseq | NP_001127757 |
MIM | 602969 |
UniProt ID | P62508 |
◆ Recombinant Proteins | ||
ESRRG-2105H | Recombinant Human ESRRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ESRRG-3511H | Recombinant Human ESRRG Protein, GST-tagged | +Inquiry |
ESRRG-870H | Recombinant Human ESRRG Protein, His (Fc)-Avi-tagged | +Inquiry |
ESRRG-4420H | Recombinant Human ESRRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ESRRG-2870M | Recombinant Mouse ESRRG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESRRG-6536HCL | Recombinant Human ESRRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESRRG Products
Required fields are marked with *
My Review for All ESRRG Products
Required fields are marked with *