Recombinant Human EVL, His-tagged
| Cat.No. : | EVL-28553TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 26-268 of Human Enah/Vasp-like with N terminal His tag; 243 amino acids, 28kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-268 a.a. |
| Description : | Ena/VASP-like protein is a member of the Ena/VASP family of proteins that in humans is encoded by the EVL gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINY SIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTF SNAMLFALNIMNSQEGGPSSQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSC SGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDE SSMSGLAAAIAGAKLRRVQRPEDASGGSSPSGTSKSDANR ASSGGGGGG |
| Gene Name | EVL Enah/Vasp-like [ Homo sapiens ] |
| Official Symbol | EVL |
| Synonyms | EVL; Enah/Vasp-like; ena/VASP-like protein; RNB6; |
| Gene ID | 51466 |
| mRNA Refseq | NM_016337 |
| Protein Refseq | NP_057421 |
| Uniprot ID | Q9UI08 |
| Chromosome Location | 14q32.32 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem; |
| Function | SH3 domain binding; actin binding; profilin binding; protein binding; |
| ◆ Recombinant Proteins | ||
| EVL-28553TH | Recombinant Human EVL, His-tagged | +Inquiry |
| Evl-5158M | Recombinant Mouse Evl protein | +Inquiry |
| Evl-1445M | Recombinant Mouse Evl Protein, His&GST-tagged | +Inquiry |
| Evl-6421M | Recombinant Mouse Evl protein, His&Myc-tagged | +Inquiry |
| EVL-2163R | Recombinant Rat EVL Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EVL-6516HCL | Recombinant Human EVL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EVL Products
Required fields are marked with *
My Review for All EVL Products
Required fields are marked with *
