Recombinant Human EXOC7, GST-tagged
Cat.No. : | EXOC7-283H |
Product Overview : | Recombinant Human EXOC7(586 a.a. - 684 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKN PEKYIKYGVEQVGDMIDRLFDTSA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOC7 exocyst complex component 7 [ Homo sapiens (human) ] |
Official Symbol | EXOC7 |
Synonyms | EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; exocyst complex component Exo70 |
Gene ID | 23265 |
mRNA Refseq | NM_001013839 |
Protein Refseq | NP_001013861 |
MIM | 608163 |
UniProt ID | Q9UPT5 |
Chromosome Location | 17q25.1 |
Pathway | Arf6 trafficking events; Insulin Pathway; Insulin signaling pathway |
Function | protein binding |
◆ Recombinant Proteins | ||
EXOC7-5377M | Recombinant Mouse EXOC7 Protein | +Inquiry |
EXOC7-2899M | Recombinant Mouse EXOC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EXOC7-284H | Recombinant Human EXOC7, MYC/DDK-tagged | +Inquiry |
EXOC7-283H | Recombinant Human EXOC7, GST-tagged | +Inquiry |
EXOC7-2170R | Recombinant Rat EXOC7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOC7-6507HCL | Recombinant Human EXOC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOC7 Products
Required fields are marked with *
My Review for All EXOC7 Products
Required fields are marked with *