Recombinant Human EXOC7, GST-tagged

Cat.No. : EXOC7-283H
Product Overview : Recombinant Human EXOC7(586 a.a. - 684 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
Molecular Mass : 36.63 kDa
AA Sequence : VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKN PEKYIKYGVEQVGDMIDRLFDTSA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOC7 exocyst complex component 7 [ Homo sapiens (human) ]
Official Symbol EXOC7
Synonyms EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; exocyst complex component Exo70
Gene ID 23265
mRNA Refseq NM_001013839
Protein Refseq NP_001013861
MIM 608163
UniProt ID Q9UPT5
Chromosome Location 17q25.1
Pathway Arf6 trafficking events; Insulin Pathway; Insulin signaling pathway
Function protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOC7 Products

Required fields are marked with *

My Review for All EXOC7 Products

Required fields are marked with *

0
cart-icon