Recombinant Human FABP7 Full Length protein, His-tagged
| Cat.No. : | FABP7-2437H |
| Product Overview : | Recombinant Human FABP7 protein(1-132 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 31, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-132 aa |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 19 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
| Gene Name | FABP7 fatty acid binding protein 7, brain [ Homo sapiens ] |
| Official Symbol | FABP7 |
| Synonyms | FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313; |
| Gene ID | 2173 |
| mRNA Refseq | NM_001446 |
| Protein Refseq | NP_001437 |
| MIM | 602965 |
| UniProt ID | O15540 |
| ◆ Recombinant Proteins | ||
| FABP7-1363R | Recombinant Rhesus Macaque FABP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FABP7-654H | Recombinant Human FABP7 protein, MYC/DDK-tagged, C13/N15-labeled | +Inquiry |
| FABP7-1847R | Recombinant Rat FABP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FABP7-2437H | Recombinant Human FABP7 Full Length protein, His-tagged | +Inquiry |
| FABP7-370H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP7 Products
Required fields are marked with *
My Review for All FABP7 Products
Required fields are marked with *
