Recombinant Human FABP7 Full Length protein, His-tagged
Cat.No. : | FABP7-2437H |
Product Overview : | Recombinant Human FABP7 protein(1-132 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-132 aa |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 19 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Gene Name | FABP7 fatty acid binding protein 7, brain [ Homo sapiens ] |
Official Symbol | FABP7 |
Synonyms | FABP7; fatty acid binding protein 7, brain; fatty acid-binding protein, brain; B FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; FABPB; B-FABP; DKFZp547J2313; |
Gene ID | 2173 |
mRNA Refseq | NM_001446 |
Protein Refseq | NP_001437 |
MIM | 602965 |
UniProt ID | O15540 |
◆ Recombinant Proteins | ||
FABP7-4882HFL | Recombinant Full Length Human FABP7 protein, Flag-tagged | +Inquiry |
FABP7-1838H | Recombinant Human FABP7 protein, His-tagged | +Inquiry |
Fabp7-6757M | Recombinant Mouse Fabp7 protein, His-tagged | +Inquiry |
FABP7-1847R | Recombinant Rat FABP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP7-02H | Recombinant Human FABP7 Protein, GFP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP7-6474HCL | Recombinant Human FABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP7 Products
Required fields are marked with *
My Review for All FABP7 Products
Required fields are marked with *
0
Inquiry Basket