Recombinant Human FAHD1 protein, His-tagged
| Cat.No. : | FAHD1-3013H |
| Product Overview : | Recombinant Human FAHD1 protein(28-226 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-226 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLPKVSSATLPVRLQE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ] |
| Official Symbol | FAHD1 |
| Synonyms | FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046; |
| Gene ID | 81889 |
| mRNA Refseq | NM_001018104 |
| Protein Refseq | NP_001018114 |
| UniProt ID | Q6P587 |
| ◆ Recombinant Proteins | ||
| FAHD1-2873Z | Recombinant Zebrafish FAHD1 | +Inquiry |
| FAHD1-1369R | Recombinant Rhesus Macaque FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fahd1-2907M | Recombinant Mouse Fahd1 Protein, Myc/DDK-tagged | +Inquiry |
| FAHD1-1855R | Recombinant Rat FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAHD1-5116C | Recombinant Chicken FAHD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAHD1-250HCL | Recombinant Human FAHD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAHD1 Products
Required fields are marked with *
My Review for All FAHD1 Products
Required fields are marked with *
