Recombinant Human FAM114A1 protein, His-tagged
Cat.No. : | FAM114A1-3578H |
Product Overview : | Recombinant Human FAM114A1 protein(305-538 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 305-538 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM114A1 family with sequence similarity 114, member A1 [ Homo sapiens ] |
Official Symbol | FAM114A1 |
Synonyms | FAM114A1; family with sequence similarity 114, member A1; protein NOXP20; Noxp20; nervous system overexpressed protein 20; nervous system over-expressed protein 20; FLJ33151; |
Gene ID | 92689 |
mRNA Refseq | NM_138389 |
Protein Refseq | NP_612398 |
UniProt ID | Q8IWE2 |
◆ Recombinant Proteins | ||
FAM114A1-5583Z | Recombinant Zebrafish FAM114A1 | +Inquiry |
FAM114A1-3578H | Recombinant Human FAM114A1 protein, His-tagged | +Inquiry |
Fam114a1-2911M | Recombinant Mouse Fam114a1 Protein, Myc/DDK-tagged | +Inquiry |
FAM114A1-3677H | Recombinant Human FAM114A1 Protein, GST-tagged | +Inquiry |
FAM114A1-12657H | Recombinant Human FAM114A1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM114A1-6450HCL | Recombinant Human FAM114A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM114A1 Products
Required fields are marked with *
My Review for All FAM114A1 Products
Required fields are marked with *
0
Inquiry Basket