Recombinant Human FAM134C protein, His-tagged
Cat.No. : | FAM134C-3206H |
Product Overview : | Recombinant Human FAM134C protein(1-127 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-127 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPDALDNESW |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM134C family with sequence similarity 134, member C [ Homo sapiens ] |
Official Symbol | FAM134C |
Synonyms | FAM134C; family with sequence similarity 134, member C; protein FAM134C; DKFZp686B1036; FLJ33806; |
Gene ID | 162427 |
mRNA Refseq | NM_178126 |
Protein Refseq | NP_835227 |
UniProt ID | Q86VR2 |
◆ Recombinant Proteins | ||
FAM134C-3206H | Recombinant Human FAM134C protein, His-tagged | +Inquiry |
FAM134C-5497M | Recombinant Mouse FAM134C Protein | +Inquiry |
FAM134C-1571R | Recombinant Rhesus monkey FAM134C Protein, His-tagged | +Inquiry |
FAM134C-1396R | Recombinant Rhesus Macaque FAM134C Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM134C-2987M | Recombinant Mouse FAM134C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM134C-6425HCL | Recombinant Human FAM134C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM134C Products
Required fields are marked with *
My Review for All FAM134C Products
Required fields are marked with *