Recombinant Human FAM241B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM241B-3739H
Product Overview : C10orf35 MS Standard C13 and N15-labeled recombinant protein (NP_660349) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM241B (Family With Sequence Similarity 241 Member B) is a Protein Coding gene. Diseases associated with FAM241B include Yunis-Varon Syndrome. An important paralog of this gene is FAM241A.
Molecular Mass : 13.2 kDa
AA Sequence : MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM241B family with sequence similarity 241 member B [ Homo sapiens (human) ]
Official Symbol FAM241B
Synonyms FAM241B; family with sequence similarity 241 member B; C10orf35; protein FAM241B; uncharacterized protein C10orf35
Gene ID 219738
mRNA Refseq NM_145306
Protein Refseq NP_660349
UniProt ID Q96D05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM241B Products

Required fields are marked with *

My Review for All FAM241B Products

Required fields are marked with *

0
cart-icon