Recombinant Human FAM241B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM241B-3739H
• Product Overview: C10orf35 MS Standard C13 and N15-labeled recombinant protein (NP_660349) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM241B (Family With Sequence Similarity 241 Member B) is a Protein Coding gene. Diseases associated with FAM241B include Yunis-Varon Syndrome. An important paralog of this gene is FAM241A.
• Molecular Mass: 13.2 kDa
• AA Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM241B family with sequence similarity 241 member B [ Homo sapiens (human) ]
• Official Symbol: FAM241B
• Synonyms: FAM241B; family with sequence similarity 241 member B; C10orf35; protein FAM241B; uncharacterized protein C10orf35
• Gene ID: 219738
• mRNA Refseq: NM_145306
• Protein Refseq: NP_660349
• UniProt ID: Q96D05