Recombinant Human FAM89B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FAM89B-4031H |
| Product Overview : | FAM89B MS Standard C13 and N15-labeled recombinant protein (NP_001092255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | FAM89B (Family With Sequence Similarity 89 Member B) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transcription corepressor binding. An important paralog of this gene is FAM89A. |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFHISLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FAM89B family with sequence similarity 89 member B [ Homo sapiens (human) ] |
| Official Symbol | FAM89B |
| Synonyms | FAM89B; family with sequence similarity 89, member B; protein FAM89B; mammary tumor virus receptor homolog 1; MTVR1; |
| Gene ID | 23625 |
| mRNA Refseq | NM_001098785 |
| Protein Refseq | NP_001092255 |
| MIM | 616128 |
| UniProt ID | Q8N5H3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM89B Products
Required fields are marked with *
My Review for All FAM89B Products
Required fields are marked with *



