Recombinant Human FBXL3 protein, GST-tagged FBXL3-32H

Recombinant Human FBXL3 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FBXL3 protein, GST-tagged

Recombinant Human FBXL3 protein, GST-tagged

FBXL3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FBXL3-32H
Product Overview : Recombinant Human FBXL3(1 a.a. - 428 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 75.1 kDa
AA Sequence : MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDL WRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARP SFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHG LRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKNLSAIGLGECEVSCSA FVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVWFPDMMPTW
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : FBXL3 F-box and leucine-rich repeat protein 3 [ Homo sapiens ]
Official Symbol : FBXL3
Synonyms : FBXL3; F-box and leucine-rich repeat protein 3; F box and leucine rich repeat protein 3A , FBXL3A; F-box/LRR-repeat protein 3; FBL3; FBL3A; F-box protein Fbl3a; F-box/LRR-repeat protein 3A; F-box and leucine-rich repeat protein 3A; FBXL3A;
Gene ID : 26224
mRNA Refseq : NM_012158
Protein Refseq : NP_036290
MIM : 605653
UniProt ID : Q9UKT7
Chromosome Location : 13q22
Pathway : Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function : protein binding; contributes_to ubiquitin-protein ligase activity; ubiquitin-protein ligase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy