Recombinant Human FBXL3 protein, GST-tagged

• Cat.No.: FBXL3-32H
• Product Overview: Recombinant Human FBXL3(1 a.a. - 428 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-428 a.a.
• Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 75.1 kDa
• AA Sequence: MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDL WRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARP SFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHG LRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKNLSAIGLGECEVSCSA FVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVWFPDMMPTW
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: FBXL3 F-box and leucine-rich repeat protein 3 [ Homo sapiens ]
• Official Symbol: FBXL3
• Synonyms: FBXL3; F-box and leucine-rich repeat protein 3; F box and leucine rich repeat protein 3A , FBXL3A; F-box/LRR-repeat protein 3; FBL3; FBL3A; F-box protein Fbl3a; F-box/LRR-repeat protein 3A; F-box and leucine-rich repeat protein 3A; FBXL3A
• Gene ID: 26224
• mRNA Refseq: NM_012158
• Protein Refseq: NP_036290
• MIM: 605653
• UniProt ID: Q9UKT7
• Chromosome Location: 13q22
• Pathway: Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: protein binding; contributes_to ubiquitin-protein ligase activity; ubiquitin-protein ligase activity