Recombinant Human FCGR3B Protein, Fc/His-tagged
| Cat.No. : | FCGR3B-284H |
| Product Overview : | Recombinant Human FCGR3B fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Description : | Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils. |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 49.3kD |
| AA Sequence : | TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ] |
| Official Symbol | FCGR3B |
| Synonyms | FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; |
| Gene ID | 2215 |
| mRNA Refseq | NM_000570 |
| Protein Refseq | NP_000561 |
| MIM | 610665 |
| UniProt ID | O75015 |
| ◆ Recombinant Proteins | ||
| FCGR3B-3869H | Recombinant Human FCGR3B protein(Met18-Gly193) | +Inquiry |
| FCGR3B-4111H | Recombinant Human FCGR3B Protein (Met1-Ser200), C-His tagged | +Inquiry |
| FCGR3B-431H | Recombinant Human FCGR3B protein, His-Avi-tagged, Biotinylated | +Inquiry |
| FCGR3B-1473H | Recombinant Human FCGR3B Protein, His-tagged | +Inquiry |
| FCGR3B-315H | Recombinant Human FCGR3B protein (Met 1-Ser 200 (Ala 78 Asp)), SH allotype, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR3B-001HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
| FCGR3B-3055HCL | Recombinant Human FCGR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR3B Products
Required fields are marked with *
My Review for All FCGR3B Products
Required fields are marked with *



