Recombinant Human FCRL4 protein, His-tagged
Cat.No. : | FCRL4-920H |
Product Overview : | Recombinant Human FCRL4(20-387aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-387aa |
Description : | This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma |
Form : | 20mM Tris-HCl based buffer,pH8.0 |
Molecular Mass : | 48.68kDa |
AA Sequence : | AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRE SGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWN GNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATD SQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSY WCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDT TFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRE TPGNRDGL |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | FCRL4 Fc receptor-like 4 [ Homo sapiens ] |
Official Symbol | FCRL4 |
Synonyms | FCRL4; Fc receptor-like 4; Fc receptor-like protein 4; CD307d; FCRH4; IGFP2; IRTA1; hIFGP2; fcR-like protein 4; IFGP family protein 2; fc receptor homolog 4; immunoglobulin superfamily Fc receptor, gp42; immune receptor translocation-associated protein 1; immunoglobulin superfamily receptor translocation associated 1; MGC150522; MGC150523; |
Gene ID | 83417 |
mRNA Refseq | NM_031282 |
Protein Refseq | NP_112572 |
MIM | 605876 |
UniProt ID | Q96PJ5 |
Chromosome Location | 1q21 |
Function | protein binding; receptor activity; |
◆ Recombinant Proteins | ||
FCRL4-151H | Recombinant Human FCRL4 Protein, DYKDDDDK-tagged | +Inquiry |
FCRL4-1843H | Recombinant Human FCRL4 Protein (20-387 aa), His-tagged | +Inquiry |
FCRL4-920H | Recombinant Human FCRL4 protein, His-tagged | +Inquiry |
FCRL4-1798H | Recombinant Human FCRL4 Protein (20-387 aa), His-SUMO-tagged | +Inquiry |
FCRL4-12H | Recombinant Human FCRL4 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL4-6274HCL | Recombinant Human FCRL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCRL4 Products
Required fields are marked with *
My Review for All FCRL4 Products
Required fields are marked with *