Recombinant Human FCRL4 protein, His-tagged

Cat.No. : FCRL4-920H
Product Overview : Recombinant Human FCRL4(20-387aa) fused with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-387aa
Description : This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma
Form : 20mM Tris-HCl based buffer,pH8.0
Molecular Mass : 48.68kDa
AA Sequence : AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRE SGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWN GNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATD SQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSY WCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDT TFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRE TPGNRDGL
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name FCRL4 Fc receptor-like 4 [ Homo sapiens ]
Official Symbol FCRL4
Synonyms FCRL4; Fc receptor-like 4; Fc receptor-like protein 4; CD307d; FCRH4; IGFP2; IRTA1; hIFGP2; fcR-like protein 4; IFGP family protein 2; fc receptor homolog 4; immunoglobulin superfamily Fc receptor, gp42; immune receptor translocation-associated protein 1; immunoglobulin superfamily receptor translocation associated 1; MGC150522; MGC150523;
Gene ID 83417
mRNA Refseq NM_031282
Protein Refseq NP_112572
MIM 605876
UniProt ID Q96PJ5
Chromosome Location 1q21
Function protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCRL4 Products

Required fields are marked with *

My Review for All FCRL4 Products

Required fields are marked with *

0
cart-icon