"FH" Related Products

Expand
Expand
Expand

Recombinant Human FH protein, T7/His-tagged

Cat.No.: FH-205H
Product Overview: Recombinant human FH cDNA (45-510 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPT PVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEML GGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAV PLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEAL AAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGN HVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGY DKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: FH fumarate hydratase [ Homo sapiens ]
Official Symbol: FH
Synonyms: FH; fumarate hydratase; fumarate hydratase, mitochondrial; fumarase; MCL; LRCC; HLRCC; MCUL1;
Gene ID: 2271
mRNA Refseq: NM_000143
Protein Refseq: NP_000134
MIM: 136850
UniProt ID: P07954
Chromosome Location: 1q42.1
Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>oxaloacetate, organism-specific biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate, conserved biosystem; Citric acid cycle (TCA cycle), organism-specific biosystem;
Function: fumarate hydratase activity; lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.