Recombinant Human FIS1 Protein, GST-tagged
Cat.No. : | FIS1-4178H |
Product Overview : | Human FIS1 full-length ORF ( AAH03540.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM |
Molecular Mass : | 42.46 kDa |
AA Sequence : | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FIS1 fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | FIS1 |
Synonyms | FIS1; fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); fission 1 (mitochondrial outer membrane) homolog (yeast), tetratricopeptide repeat domain 11, TTC11; mitochondrial fission 1 protein; CGI 135; CGI 135 protein; Fis1; H_NH0132A01.6; hFis1; FIS1 homolog; TPR repeat protein 11; tetratricopeptide repeat domain 11; tetratricopeptide repeat protein 11; TTC11; CGI-135; |
Gene ID | 51024 |
mRNA Refseq | NM_016068 |
Protein Refseq | NP_057152 |
MIM | 609003 |
UniProt ID | Q9Y3D6 |
◆ Recombinant Proteins | ||
FIS1-5115HF | Recombinant Full Length Human FIS1 Protein, GST-tagged | +Inquiry |
FIS1-3531H | Recombinant Human FIS1 Protein (Met1-Ala117), N-His tagged | +Inquiry |
FIS1-2952H | Recombinant Human FIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FIS1-917H | Recombinant Human FIS1 | +Inquiry |
FIS1-1535R | Recombinant Rhesus Macaque FIS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIS1-6216HCL | Recombinant Human FIS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIS1 Products
Required fields are marked with *
My Review for All FIS1 Products
Required fields are marked with *
0
Inquiry Basket