Recombinant Human FLJ45337 Protein, GST-tagged
Cat.No. : | FLJ45337-4349H |
Product Overview : | Human FLJ45337 full-length ORF ( NP_997348.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MCTWYAAIDLANAFFSIPVHKAHQKQFAFSWQGQQYTFTVLPQRYSNSPALCHNLIRRDLDCFLLLQSITLVHYIDDIMLIGSSEQEVASTLDLLVRHLYARGWEINPTKIKETSTSVKFLGVQWCGACQDIPSKVKDKLLHLATPTTKKEAQCLLGRFGFWRQHGPYLGALLWPIYQVTSKAASFEWGPEQEKALQQVQAAVQAALLLGPHDPADPMVLEVSVADRDAVWSLWQAPIGESWQRPLGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLJ45337 FLJ45337 protein [ Homo sapiens (human) ] |
Official Symbol | FLJ45337 |
Synonyms | FLJ45337; FLJ45337 protein; FLJ45337 protein |
Gene ID | 400754 |
◆ Recombinant Proteins | ||
FLJ45337-4349H | Recombinant Human FLJ45337 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLJ45337 Products
Required fields are marked with *
My Review for All FLJ45337 Products
Required fields are marked with *