Recombinant Human FLJ45337 Protein, GST-tagged

Cat.No. : FLJ45337-4349H
Product Overview : Human FLJ45337 full-length ORF ( NP_997348.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Molecular Mass : 54.4 kDa
AA Sequence : MCTWYAAIDLANAFFSIPVHKAHQKQFAFSWQGQQYTFTVLPQRYSNSPALCHNLIRRDLDCFLLLQSITLVHYIDDIMLIGSSEQEVASTLDLLVRHLYARGWEINPTKIKETSTSVKFLGVQWCGACQDIPSKVKDKLLHLATPTTKKEAQCLLGRFGFWRQHGPYLGALLWPIYQVTSKAASFEWGPEQEKALQQVQAAVQAALLLGPHDPADPMVLEVSVADRDAVWSLWQAPIGESWQRPLGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLJ45337 FLJ45337 protein [ Homo sapiens (human) ]
Official Symbol FLJ45337
Synonyms FLJ45337; FLJ45337 protein; FLJ45337 protein
Gene ID 400754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLJ45337 Products

Required fields are marked with *

My Review for All FLJ45337 Products

Required fields are marked with *

0
cart-icon
0
compare icon