Recombinant Full Length Human FLOT2 Protein, GST-tagged

Cat.No. : FLOT2-4950HF
Product Overview : Human FLOT2 full-length ORF ( AAH17292, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 379 amino acids
Description : Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
Molecular Mass : 67.43 kDa
AA Sequence : MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLOT2 flotillin 2 [ Homo sapiens ]
Official Symbol FLOT2
Synonyms FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; Flotillin 2 (epidermal surface antigen 1); membrane component; chromosome 17; surface marker 1 (35kD protein identified by monoclonal ECS 1); epidermal surface antigen; membrane component chromosome 17 surface marker 1; membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal ECS-1); ECS-1;
Gene ID 2319
mRNA Refseq NM_004475
Protein Refseq NP_004466
MIM 131560
UniProt ID Q14254

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLOT2 Products

Required fields are marked with *

My Review for All FLOT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon