Recombinant Human FLT1/KDR, Fc-tagged therapeutic protein(Aflibercept)
| Cat.No. : | FLT1 & KDR-P1006H |
| Product Overview : | The therapeutic protein is a recombinant fusion protein that comprises of two main components: the vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 which is then fused to the Fc portion of human IgG1. Structurally, it is a dimeric glycoprotein with a protein molecular weight of 96.9 kilo Daltons (kDa). It contains approximately 15% glycosylation to give a total molecular weight of 115 kDa. All five putative N-glycosylation sites on each polypeptide chain predicted by the primary sequence can be occupied with carbohydrate and exhibit some degree of chain heterogeneity, including heterogeneity in terminal sialic acid residues, except at the single unsialylated site associated with the Fc domain. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Fc |
| Description : | Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does haveeffects on a number of other cell types (e.g. stimulation monocyte/macrophagemigration, neurons, cancer cells, kidney epithelial cells).VEGF mediates increased vascular permeability, induces angiogenesis, vasculo genesisand endothelial cell growth, promotes cell migration, and inhibits apoptosis.In vitro, VEGF has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor. |
| Form : | Normally 10-50mM PB, 50-00mM Sodium Chloride and 3-7% sucrose are added, pH 6.0-6.5. |
| Molecular Mass : | 115 kDa(with glycosylation) |
| AA Sequence : | SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATY KEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPS SKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPG |
| Endotoxin : | <1.0 eu per 10 mg protein as determined by the lal |
| Purity : | >95% as determined by SDS-PAGE and HPLC |
| Stability : | Samples are stable for up to six months from date of receipt at -20 centigrade and are stable for two months at 4 centigrade. |
| Storage : | Store it under sterile conditions at -70 centigrade upon receiving. Recommend to pack the protein intosmaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. |
| Alias : | FLT1; FLT; VEGFR1; FLT-1; VEGFR-1; Aflibercept; Aflibercept (genetical recombination); Ziv-aflibercept |
| Gene Name | FLT1 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) [ Homo sapiens ] |
| Official Symbol | FLT1 |
| Synonyms | FLT1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FLT; vascular endothelial growth factor receptor 1; VEGFR1; FLT-1; VEGFR-1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor; |
| Gene ID | 2321 |
| mRNA Refseq | NM_001159920 |
| Protein Refseq | NP_001153392 |
| MIM | 165070 |
| UniProt ID | P17948 |
| Chromosome Location | 13q12 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
| Function | ATP binding; growth factor binding; nucleotide binding; protein binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity; vascular endothelial growth factor-activated receptor activity; |
| ◆ Recombinant Proteins | ||
| FLT1-2364R | Recombinant Rat FLT1 Protein | +Inquiry |
| FLT1-2804H | Recombinant Human FLT1 Protein (Met1-Ile328), C-His tagged | +Inquiry |
| FLT1-80H | Recombinant Human Fms-related Tyrosine Kinase 1, 5 Domains | +Inquiry |
| FLT1-4367H | Active Recombinant Human FLT1 Protein, GST-tagged | +Inquiry |
| Flt1-1840R | Recombinant Rat Flt1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT1-1207RCL | Recombinant Rat FLT1 cell lysate | +Inquiry |
| FLT1-1909HCL | Recombinant Human FLT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT1 Products
Required fields are marked with *
My Review for All FLT1 Products
Required fields are marked with *
