"FOXA3" Related Products

Expand

Recombinant Human FOXA3(T58A) protein, Arginine-tagged

Cat.No. : FOXA3-151H
Product Overview : Recombinant human cMyc (T58A mutant) protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source : E. coli
Species : Human
Tag : Arginine
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity : 1. DNA binding activity was demonstrated using cMyc specific DNA binding oligo derived ELISA.2. Mouse iPS generation activity was measured for each lot of products.
AA Sequence : MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLP(T to A)PPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCAESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for PiPs application in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name : FOXA3 forkhead box A3 [ Homo sapiens ]
Official Symbol : FOXA3
Synonyms : FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma , HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; FKHH3; HNF3G; TCF3G; MGC10179;
Gene ID : 3171
mRNA Refseq : NM_004497
Protein Refseq : NP_004488
MIM : 602295
UniProt ID : P55318
Chromosome Location : 19q13.2-q13.4
Pathway : Developmental Biology, organism-specific biosystem; FOXA transcription factor networks, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem;
Function : DNA binding, bending; double-stranded DNA binding; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.