Recombinant Human FOXD4L4 Protein, GST-tagged

Cat.No. : FOXD4L4-4445H
Product Overview : Human FOXD4L4 partial ORF ( NP_954714.2, 317 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FOXD4L4 (Forkhead Box D4-Like 4) is a Protein Coding gene. Diseases associated with FOXD4L4 include Leukemia, Acute Myeloid. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXD4L5.
Molecular Mass : 36.74 kDa
AA Sequence : HREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPKPLPLCCKCPPPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXD4L4 forkhead box D4 like 4 [ Homo sapiens (human) ]
Official Symbol FOXD4L4
Synonyms FOXD4L4; forkhead box D4 like 4; FOXD4b; FOXD4L2; bA460E7.2; forkhead box protein D4-like 4; FOXD4-like 4; forkhead box D4-like 2; forkhead box protein D4-like 2; forkhead box protein D4b; myeloid factor-gamma; winged helix factor-1; winged helix transcription factor beta
Gene ID 349334
mRNA Refseq NM_199244
Protein Refseq NP_954714
MIM 611085
UniProt ID Q8WXT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXD4L4 Products

Required fields are marked with *

My Review for All FOXD4L4 Products

Required fields are marked with *

0
cart-icon
0
compare icon