Recombinant Human FSTL1 protein(176-285aa), His-GST-tagged
Cat.No. : | FSTL1-2065H |
Product Overview : | Recombinant Human FSTL1 protein(Q12841)(176-285aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 176-285aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR |
Gene Name | FSTL1 follistatin-like 1 [ Homo sapiens ] |
Official Symbol | FSTL1 |
Synonyms | FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277; |
Gene ID | 11167 |
mRNA Refseq | NM_007085 |
Protein Refseq | NP_009016 |
MIM | 605547 |
UniProt ID | Q12841 |
◆ Recombinant Proteins | ||
FSTL1-2895H | Recombinant Human FSTL1, T7-tagged | +Inquiry |
Fstl1-3093M | Recombinant Mouse Fstl1 Protein, Myc/DDK-tagged | +Inquiry |
Fstl1-1139H | Recombinant Human Fstl1 Protein, His-tagged | +Inquiry |
FSTL1-2055R | Recombinant Rat FSTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FSTL1-3457H | Recombinant Human FSTL1 Protein (Glu21-Ile308), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL1-2679HCL | Recombinant Human FSTL1 cell lysate | +Inquiry |
FSTL1-001MCL | Recombinant Mouse FSTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSTL1 Products
Required fields are marked with *
My Review for All FSTL1 Products
Required fields are marked with *
0
Inquiry Basket