Recombinant Human FSTL1 protein(176-285aa), His-GST-tagged
| Cat.No. : | FSTL1-2065H |
| Product Overview : | Recombinant Human FSTL1 protein(Q12841)(176-285aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 176-285aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR |
| Gene Name | FSTL1 follistatin-like 1 [ Homo sapiens ] |
| Official Symbol | FSTL1 |
| Synonyms | FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277; |
| Gene ID | 11167 |
| mRNA Refseq | NM_007085 |
| Protein Refseq | NP_009016 |
| MIM | 605547 |
| UniProt ID | Q12841 |
| ◆ Recombinant Proteins | ||
| FSTL1-2979H | Recombinant Human FSTL1, GST-tagged | +Inquiry |
| Fstl1-5671M | Recombinant Mouse Fstl1 Protein (Glu19-Ile306), C-His tagged | +Inquiry |
| FSTL1-3459H | Recombinant Human FSTL1 Protein (Met1-Ile308), N-His tagged | +Inquiry |
| Fstl1-1618R | Recombinant Rat Fstl1 protein, His-tagged | +Inquiry |
| FSTL1-939H | Recombinant Human FSTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FSTL1-001MCL | Recombinant Mouse FSTL1 cell lysate | +Inquiry |
| FSTL1-2679HCL | Recombinant Human FSTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL1 Products
Required fields are marked with *
My Review for All FSTL1 Products
Required fields are marked with *
