Recombinant Human FSTL1 protein(151-300 aa), C-His-tagged

• Cat.No.: FSTL1-2833H
• Product Overview: Recombinant Human FSTL1 protein(Q12841)(151-300 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-300 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT

Gene Information

• Gene Name: FSTL1 follistatin-like 1 [ Homo sapiens ]
• Official Symbol: FSTL1
• Synonyms: FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277
• Gene ID: 11167
• mRNA Refseq: NM_007085
• Protein Refseq: NP_009016
• MIM: 605547
• UniProt ID: Q12841