Recombinant Human FSTL1 protein(151-300 aa), C-His-tagged
Cat.No. : | FSTL1-2833H |
Product Overview : | Recombinant Human FSTL1 protein(Q12841)(151-300 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 151-300 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT |
Gene Name | FSTL1 follistatin-like 1 [ Homo sapiens ] |
Official Symbol | FSTL1 |
Synonyms | FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277; |
Gene ID | 11167 |
mRNA Refseq | NM_007085 |
Protein Refseq | NP_009016 |
MIM | 605547 |
UniProt ID | Q12841 |
◆ Recombinant Proteins | ||
FSTL1-2399R | Recombinant Rat FSTL1 Protein | +Inquiry |
Fstl1-379R | Recombinant Rat FSTL1 Protein, His-tagged | +Inquiry |
Fstl1-5671M | Recombinant Mouse Fstl1 Protein (Glu19-Ile306), C-His tagged | +Inquiry |
FSTL1-6206C | Recombinant Chicken FSTL1 | +Inquiry |
FSTL1-819H | Recombinant Human FSTL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSTL1-2679HCL | Recombinant Human FSTL1 cell lysate | +Inquiry |
FSTL1-001MCL | Recombinant Mouse FSTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSTL1 Products
Required fields are marked with *
My Review for All FSTL1 Products
Required fields are marked with *
0
Inquiry Basket