Recombinant Human FSTL1 protein(151-300 aa), C-His-tagged

Cat.No. : FSTL1-2833H
Product Overview : Recombinant Human FSTL1 protein(Q12841)(151-300 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 151-300 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
Gene Name FSTL1 follistatin-like 1 [ Homo sapiens ]
Official Symbol FSTL1
Synonyms FSTL1; follistatin-like 1; follistatin-related protein 1; FRP; FSL1; follistatin-like protein 1; FLJ50214; FLJ52277;
Gene ID 11167
mRNA Refseq NM_007085
Protein Refseq NP_009016
MIM 605547
UniProt ID Q12841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSTL1 Products

Required fields are marked with *

My Review for All FSTL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon