Recombinant Human GADD45B protein, His-tagged

• Cat.No.: GADD45B-3904H
• Product Overview: Recombinant Human GADD45B protein(1-160 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-160 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens ]
• Official Symbol: GADD45B
• Synonyms: GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133
• Gene ID: 4616
• mRNA Refseq: NM_015675
• Protein Refseq: NP_056490
• MIM: 604948
• UniProt ID: O75293