Recombinant Human GADD45B protein, His-tagged
| Cat.No. : | GADD45B-3904H |
| Product Overview : | Recombinant Human GADD45B protein(1-160 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-160 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens ] |
| Official Symbol | GADD45B |
| Synonyms | GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133; |
| Gene ID | 4616 |
| mRNA Refseq | NM_015675 |
| Protein Refseq | NP_056490 |
| MIM | 604948 |
| UniProt ID | O75293 |
| ◆ Recombinant Proteins | ||
| GADD45B-6163M | Recombinant Mouse GADD45B Protein | +Inquiry |
| GADD45B-292H | Recombinant Human GADD45B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GADD45B-3458C | Recombinant Chicken GADD45B | +Inquiry |
| GADD45B-1370H | Recombinant Human Growth Arrest And DNA-damage-inducible, Beta | +Inquiry |
| GADD45B-13110H | Recombinant Human GADD45B, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GADD45B-6054HCL | Recombinant Human GADD45B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45B Products
Required fields are marked with *
My Review for All GADD45B Products
Required fields are marked with *
