Recombinant Human GADD45B protein, His-tagged
Cat.No. : | GADD45B-3904H |
Product Overview : | Recombinant Human GADD45B protein(1-160 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-160 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens ] |
Official Symbol | GADD45B |
Synonyms | GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133; |
Gene ID | 4616 |
mRNA Refseq | NM_015675 |
Protein Refseq | NP_056490 |
MIM | 604948 |
UniProt ID | O75293 |
◆ Recombinant Proteins | ||
GADD45B-1799R | Recombinant Rhesus monkey GADD45B Protein, His-tagged | +Inquiry |
GADD45B-3904H | Recombinant Human GADD45B protein, His-tagged | +Inquiry |
GADD45B-4659H | Recombinant Human GADD45B Protein, GST-tagged | +Inquiry |
Gadd45b-3131M | Recombinant Mouse Gadd45b Protein, Myc/DDK-tagged | +Inquiry |
GADD45B-3440M | Recombinant Mouse GADD45B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45B-6054HCL | Recombinant Human GADD45B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GADD45B Products
Required fields are marked with *
My Review for All GADD45B Products
Required fields are marked with *
0
Inquiry Basket