Recombinant Human GADD45G protein, GST-tagged
Cat.No. : | GADD45G-410H |
Product Overview : | Recombinant Human GADD45G protein(NP_006696)(1-127 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-127 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ] |
Official Symbol | GADD45G |
Synonyms | GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; |
Gene ID | 10912 |
mRNA Refseq | NM_006705 |
Protein Refseq | NP_006696 |
MIM | 604949 |
UniProt ID | O95257 |
◆ Recombinant Proteins | ||
GADD45G-955H | Recombinant Human GADD45G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GADD45G-5208HF | Recombinant Full Length Human GADD45G Protein, GST-tagged | +Inquiry |
GADD45G-334H | Recombinant Human GADD45G, None tagged | +Inquiry |
GADD45G-0305H | Recombinant Human GADD45G protein | +Inquiry |
Gadd45g-3132M | Recombinant Mouse Gadd45g Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GADD45G-6053HCL | Recombinant Human GADD45G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45G Products
Required fields are marked with *
My Review for All GADD45G Products
Required fields are marked with *