Recombinant Human GADD45G protein, GST-tagged
| Cat.No. : | GADD45G-410H |
| Product Overview : | Recombinant Human GADD45G protein(NP_006696)(1-127 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-127 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ] |
| Official Symbol | GADD45G |
| Synonyms | GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; |
| Gene ID | 10912 |
| mRNA Refseq | NM_006705 |
| Protein Refseq | NP_006696 |
| MIM | 604949 |
| UniProt ID | O95257 |
| ◆ Recombinant Proteins | ||
| GADD45G-955H | Recombinant Human GADD45G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GADD45G-410H | Recombinant Human GADD45G protein, GST-tagged | +Inquiry |
| Gadd45g-3132M | Recombinant Mouse Gadd45g Protein, Myc/DDK-tagged | +Inquiry |
| GADD45G-1621R | Recombinant Rhesus Macaque GADD45G Protein, His (Fc)-Avi-tagged | +Inquiry |
| GADD45G-4660H | Recombinant Human GADD45G Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GADD45G-6053HCL | Recombinant Human GADD45G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45G Products
Required fields are marked with *
My Review for All GADD45G Products
Required fields are marked with *
