Recombinant Human GADD45G protein, GST-tagged

Cat.No. : GADD45G-410H
Product Overview : Recombinant Human GADD45G protein(NP_006696)(1-127 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-127 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ]
Official Symbol GADD45G
Synonyms GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein;
Gene ID 10912
mRNA Refseq NM_006705
Protein Refseq NP_006696
MIM 604949
UniProt ID O95257

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GADD45G Products

Required fields are marked with *

My Review for All GADD45G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon