Recombinant Human GAGE2C Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | GAGE2C-143H |
Product Overview : | GAGE2C MS Standard C13 and N15-labeled recombinant protein (NP_001463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. |
Molecular Mass : | 12.6 kDa |
AA Sequence : | MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GAGE2C G antigen 2C [ Homo sapiens (human) ] |
Official Symbol | GAGE2C |
Synonyms | GAGE2C; G antigen 2C; CT4.2; GAGE-2; GAGE-2C; GAGE2; G antigen 2B/2C; G antigen 2; cancer/testis antigen 4.2 |
Gene ID | 2574 |
mRNA Refseq | NM_001472 |
Protein Refseq | NP_001463 |
MIM | 300595 |
UniProt ID | Q13066 |
◆ Recombinant Proteins | ||
GAGE2C-423H | Recombinant Human GAGE2C | +Inquiry |
GAGE2C-143H | Recombinant Human GAGE2C Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GAGE2C-3001H | Recombinant Human GAGE2C Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE2C Products
Required fields are marked with *
My Review for All GAGE2C Products
Required fields are marked with *