Recombinant Human GAGE6 Protein, GST-tagged
| Cat.No. : | GAGE6-4667H |
| Product Overview : | Human GAGE6 full-length ORF ( AAI48436.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq |
| Molecular Mass : | 39.27 kDa |
| AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAGE6 G antigen 6 [ Homo sapiens (human) ] |
| Official Symbol | GAGE6 |
| Synonyms | GAGE6; G antigen 6; CT4.6; G antigen 6; GAGE-6; cancer/testis antigen 4.6; cancer/testis antigen family 4, member 6 |
| Gene ID | 2578 |
| mRNA Refseq | NM_001476 |
| Protein Refseq | NP_001467 |
| MIM | 300599 |
| UniProt ID | Q13070 |
| ◆ Recombinant Proteins | ||
| GAGE6-4667H | Recombinant Human GAGE6 Protein, GST-tagged | +Inquiry |
| GAGE6-5214HF | Recombinant Full Length Human GAGE6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE6 Products
Required fields are marked with *
My Review for All GAGE6 Products
Required fields are marked with *
