Recombinant Human GALNT13 Protein, GST-tagged
Cat.No. : | GALNT13-4693H |
Product Overview : | Human GALNT13 full-length ORF ( NP_443149.1, 1 a.a. - 556 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM |
Molecular Mass : | 90.4 kDa |
AA Sequence : | MRRSVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GALNT13 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) [ Homo sapiens ] |
Official Symbol | GALNT13 |
Synonyms | GALNT13; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13); polypeptide N-acetylgalactosaminyltransferase 13; GalNAc T13; KIAA1918; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 13; pp-GaNTase 13; GalNAc transferase 13; polypeptide GalNAc transferase 13; protein-UDP acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13; GalNAc-T13; FLJ16031; FLJ41157; H_NH0187G20.1; MGC119459; MGC119461; WUGSC:H_NH0187G20.1; |
Gene ID | 114805 |
mRNA Refseq | NM_052917 |
Protein Refseq | NP_443149 |
MIM | 608369 |
UniProt ID | Q8IUC8 |
◆ Recombinant Proteins | ||
Galnt13-3142M | Recombinant Mouse Galnt13 Protein, Myc/DDK-tagged | +Inquiry |
GALNT13-622H | Active Recombinant Human GALNT13 protein, His-tagged | +Inquiry |
GALNT13-623H | Recombinant Human GALNT13 protein, MYC/DDK-tagged | +Inquiry |
GALNT13-2467R | Recombinant Rat GALNT13 Protein | +Inquiry |
GALNT13-2123R | Recombinant Rat GALNT13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT13-6038HCL | Recombinant Human GALNT13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALNT13 Products
Required fields are marked with *
My Review for All GALNT13 Products
Required fields are marked with *
0
Inquiry Basket