Recombinant Human GALP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GALP-5790H
• Product Overview: GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.
• Molecular Mass: 12.4 kDa
• AA Sequence: MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GALP galanin-like peptide [ Homo sapiens (human) ]
• Official Symbol: GALP
• Synonyms: GALP; galanin-like peptide; alarin; gal-like peptide
• Gene ID: 85569
• mRNA Refseq: NM_033106
• Protein Refseq: NP_149097
• MIM: 611178
• UniProt ID: Q9UBC7