Recombinant Human GALP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GALP-5790H |
Product Overview : | GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GALP galanin-like peptide [ Homo sapiens (human) ] |
Official Symbol | GALP |
Synonyms | GALP; galanin-like peptide; alarin; gal-like peptide; |
Gene ID | 85569 |
mRNA Refseq | NM_033106 |
Protein Refseq | NP_149097 |
MIM | 611178 |
UniProt ID | Q9UBC7 |
◆ Recombinant Proteins | ||
GALP-6196M | Recombinant Mouse GALP Protein | +Inquiry |
GALP-5790H | Recombinant Human GALP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GALP-1561H | Recombinant Human GALP Protein, His&GST-tagged | +Inquiry |
GALP-4713H | Recombinant Human GALP Protein, GST-tagged | +Inquiry |
GALP-2470R | Recombinant Rat GALP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALP-6029HCL | Recombinant Human GALP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALP Products
Required fields are marked with *
My Review for All GALP Products
Required fields are marked with *