Recombinant Human GATA2 protein, Arginine-tagged

Cat.No. : GATA2-136H
Product Overview : Recombinant human GATA2 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : EVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAH ARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGG SGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESG SPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGAT ATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLY YKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGH ILPTPTPIHPSSSLSFGHPHPSSMVTAMGLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name GATA2 GATA binding protein 2 [ Homo sapiens ]
Official Symbol GATA2
Synonyms GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B; DCML; MONOMAC; MGC2306; FLJ45948;
Gene ID 2624
mRNA Refseq NM_001145661
Protein Refseq NP_001139133
MIM 137295
UniProt ID P23769
Chromosome Location 3q21
Pathway Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem;
Function C2H2 zinc finger domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding; chromatin binding; enhancer sequence-specific DNA binding; metal ion binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GATA2 Products

Required fields are marked with *

My Review for All GATA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon