Recombinant Human GCHFR Protein, GST-tagged
Cat.No. : | GCHFR-4796H |
Product Overview : | Human GCHFR full-length ORF ( NP_005249.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq |
Molecular Mass : | 36.1 kDa |
AA Sequence : | MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GCHFR GTP cyclohydrolase I feedback regulator [ Homo sapiens ] |
Official Symbol | GCHFR |
Synonyms | GCHFR; GTP cyclohydrolase I feedback regulator; GTP cyclohydrolase I feedback regulatory protein; GTP cyclohydrolase 1 feedback regulatory protein; GFRP; HsT16933; P35; MGC138467; MGC138469; |
Gene ID | 2644 |
mRNA Refseq | NM_005258 |
Protein Refseq | NP_005249 |
MIM | 602437 |
UniProt ID | P30047 |
◆ Recombinant Proteins | ||
GCHFR-4796H | Recombinant Human GCHFR Protein, GST-tagged | +Inquiry |
GCHFR-3505M | Recombinant Mouse GCHFR Protein, His (Fc)-Avi-tagged | +Inquiry |
GCHFR-11025Z | Recombinant Zebrafish GCHFR | +Inquiry |
GCHFR-6264M | Recombinant Mouse GCHFR Protein | +Inquiry |
GCHFR-2490R | Recombinant Rat GCHFR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCHFR-692HCL | Recombinant Human GCHFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCHFR Products
Required fields are marked with *
My Review for All GCHFR Products
Required fields are marked with *