Recombinant Human GCHFR Protein, GST-tagged

Cat.No. : GCHFR-4796H
Product Overview : Human GCHFR full-length ORF ( NP_005249.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq
Molecular Mass : 36.1 kDa
AA Sequence : MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GCHFR GTP cyclohydrolase I feedback regulator [ Homo sapiens ]
Official Symbol GCHFR
Synonyms GCHFR; GTP cyclohydrolase I feedback regulator; GTP cyclohydrolase I feedback regulatory protein; GTP cyclohydrolase 1 feedback regulatory protein; GFRP; HsT16933; P35; MGC138467; MGC138469;
Gene ID 2644
mRNA Refseq NM_005258
Protein Refseq NP_005249
MIM 602437
UniProt ID P30047

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCHFR Products

Required fields are marked with *

My Review for All GCHFR Products

Required fields are marked with *

0
cart-icon