Recombinant Human GFI1 protein, GST-tagged
Cat.No. : | GFI1-188H |
Product Overview : | Recombinant Human GFI1(1 a.a. - 91 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-91 a.a. |
Description : | This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.75 kDa |
AA Sequence : | MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQL RSSVCERSSEFEDFWR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GFI1 growth factor independent 1 transcription repressor [ Homo sapiens ] |
Official Symbol | GFI1 |
Synonyms | GFI1; growth factor independent 1 transcription repressor; growth factor independent 1 , ZNF163; zinc finger protein Gfi-1; zinc finger protein 163; growth factor independence-1; growth factor independent protein 1; SCN2; GFI-1; ZNF163; FLJ94509; |
Gene ID | 2672 |
mRNA Refseq | NM_005263 |
Protein Refseq | NP_005254 |
MIM | 600871 |
UniProt ID | Q99684 |
Chromosome Location | 1p22 |
Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; |
Function | DNA binding; metal ion binding; protein binding; transcription regulatory region DNA binding; zinc ion binding; |
◆ Recombinant Proteins | ||
GFI1-185H | Recombinant Human GFI1 protein, His-tagged | +Inquiry |
GFI1-1652R | Recombinant Rhesus Macaque GFI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFI1-187H | Recombinant Human GFI1 protein, His-tagged | +Inquiry |
GFI1-2510R | Recombinant Rat GFI1 Protein | +Inquiry |
GFI1-188H | Recombinant Human GFI1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFI1-5953HCL | Recombinant Human GFI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFI1 Products
Required fields are marked with *
My Review for All GFI1 Products
Required fields are marked with *