Recombinant Human GFI1 protein, GST-tagged

Cat.No. : GFI1-188H
Product Overview : Recombinant Human GFI1(1 a.a. - 91 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-91 a.a.
Description : This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.75 kDa
AA Sequence : MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQL RSSVCERSSEFEDFWR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GFI1 growth factor independent 1 transcription repressor [ Homo sapiens ]
Official Symbol GFI1
Synonyms GFI1; growth factor independent 1 transcription repressor; growth factor independent 1 , ZNF163; zinc finger protein Gfi-1; zinc finger protein 163; growth factor independence-1; growth factor independent protein 1; SCN2; GFI-1; ZNF163; FLJ94509;
Gene ID 2672
mRNA Refseq NM_005263
Protein Refseq NP_005254
MIM 600871
UniProt ID Q99684
Chromosome Location 1p22
Pathway Validated targets of C-MYC transcriptional repression, organism-specific biosystem;
Function DNA binding; metal ion binding; protein binding; transcription regulatory region DNA binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFI1 Products

Required fields are marked with *

My Review for All GFI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon