Recombinant Human GGT1 protein, T7/His-tagged

• Cat.No.: GGT1-55H
• Product Overview: Recombinant human CD224 cDNA (28-569aa, derived from BC025927) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 28-569 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGESASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLC VGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG RLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEG AQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFS RESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFY TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQP LSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVT AALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used f in vitro human glutathione metabolism mediated apoptosis regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. Potential biomarker protein for various cancer, such as endometrial cancer,4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: GGT1 gamma-glutamyltransferase 1 [ Homo sapiens ]
• Official Symbol: GGT1
• Synonyms: GGT1; gamma-glutamyltransferase 1; GGT; gamma-glutamyltranspeptidase 1; CD224; D22S672; D22S732; glutamyl transpeptidase; glutathione hydrolase 1; gamma-glutamyl transpeptidase; GTG; GGT 1; MGC96892; MGC96904; MGC96963
• Gene ID: 2678
• mRNA Refseq: NM_001032364
• Protein Refseq: NP_001027536
• MIM: 612346
• UniProt ID: P19440
• Chromosome Location: 22q11.23
• Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Glutathione conjugation, organism-specific biosystem
• Function: gamma-glutamyltransferase activity; gamma-glutamyltransferase activity; hydrolase activity; protein binding; transferase activity, transferring acyl groups