"GGT1" Related Products

Expand
Expand

Recombinant Human GGT1 protein, T7/His-tagged

Cat.No.: GGT1-55H
Product Overview: Recombinant human CD224 cDNA (28-569aa, derived from BC025927) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGESASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLC VGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG RLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEG AQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFS RESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFY TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQP LSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVT AALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Purity: >90% by SDS-PAGE
Applications: 1. May be used f in vitro human glutathione metabolism mediated apoptosis regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. Potential biomarker protein for various cancer, such as endometrial cancer,4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: GGT1 gamma-glutamyltransferase 1 [ Homo sapiens ]
Official Symbol: GGT1
Synonyms: GGT1; gamma-glutamyltransferase 1; GGT; gamma-glutamyltranspeptidase 1; CD224; D22S672; D22S732; glutamyl transpeptidase; glutathione hydrolase 1; gamma-glutamyl transpeptidase; GTG; GGT 1; MGC96892; MGC96904; MGC96963;
Gene ID: 2678
mRNA Refseq: NM_001032364
Protein Refseq: NP_001027536
MIM: 612346
UniProt ID: P19440
Chromosome Location: 22q11.23
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Glutathione conjugation, organism-specific biosystem;
Function: gamma-glutamyltransferase activity; gamma-glutamyltransferase activity; hydrolase activity; protein binding; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.