Recombinant Human GGTLC1 Protein, GST-tagged

• Cat.No.: GGTLC1-4881H
• Product Overview: Human GGTLA4 full-length ORF ( NP_563577.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
• Molecular Mass: 50.7 kDa
• AA Sequence: MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GGTLC1 gamma-glutamyltransferase light chain 1 [ Homo sapiens ]
• Official Symbol: GGTLC1
• Synonyms: gamma-glutamyltransferase light chain 1; 16437; Ensembl:ENSG00000149435; MGC50550; gamma-glutamyltransferase light chain 1;gamma-glutamyl transpeptidase;gamma-glutamyltransferase-like protein 6;gamma-glutamyltransferase-like activity 3;gamma-glutamyltransferase-like activity 4; 2.3.2.2; GGTL6; GGTLA3; GGTLA4; dJ831C21.1; dJ831C21.2
• Gene ID: 92086
• mRNA Refseq: NM_178311
• Protein Refseq: NP_842563
• MIM: 612338
• UniProt ID: Q9BX51