"GH1" Related Products

Recombinant Human GH1 Protein, His-tagged

Cat.No.: GH1-4882H
Product Overview: Huamn GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length recombinant protein with C-terminal hexahistidine tag expressed HEK293EBNA1 cells.
Description: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq
Source: HEK293EBNA1
Species: Human
Tag : His
Form: Liquid
Molecular Mass: 23.1 kDa
AA Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGSAAAHHHHHH
Applications: SDS-PAGE
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: In PBS without preservative
Gene Name: GH1 growth hormone 1 [ Homo sapiens ]
Official Symbol: GH1
Synonyms: GH1; growth hormone 1; somatotropin; GH; GH N; GHN; hGH N; pituitary growth hormone; GH-N; hGH-N; IGHD1B;
Gene ID: 2688
mRNA Refseq: NM_000515
Protein Refseq: NP_000506
MIM: 139250
UniProt ID: P01241

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.