Recombinant Human GINS3 Protein, GST-tagged
Cat.No. : | GINS3-4245H |
Product Overview : | Human FLJ13912 full-length ORF ( AAH05879, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq |
Molecular Mass : | 49.28 kDa |
AA Sequence : | MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GINS3 GINS complex subunit 3 (Psf3 homolog) [ Homo sapiens ] |
Official Symbol | GINS3 |
Synonyms | GINS3; GINS complex subunit 3 (Psf3 homolog); DNA replication complex GINS protein PSF3; FLJ13912; PSF3; |
Gene ID | 64785 |
mRNA Refseq | NM_001126129 |
Protein Refseq | NP_001119601 |
MIM | 610610 |
UniProt ID | Q9BRX5 |
◆ Recombinant Proteins | ||
Gins3-3211M | Recombinant Mouse Gins3 Protein, Myc/DDK-tagged | +Inquiry |
GINS3-4865HF | Recombinant Full Length Human GINS3 Protein, GST-tagged | +Inquiry |
GINS3-1673R | Recombinant Rhesus Macaque GINS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GINS3-6360M | Recombinant Mouse GINS3 Protein | +Inquiry |
GINS3-862Z | Recombinant Zebrafish GINS3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GINS3-5932HCL | Recombinant Human GINS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GINS3 Products
Required fields are marked with *
My Review for All GINS3 Products
Required fields are marked with *
0
Inquiry Basket