Recombinant Human GJB6 Protein, GST-tagged

• Cat.No.: GJB6-4933H
• Product Overview: Human GJB6 partial ORF ( AAH38934, 45 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed between the two inner transmembrane segments, and the N- and C-terminus both being in the cytoplasm. The specificity of the gap junction is determined by which connexin proteins comprise the hemichannel. In the past, connexin protein names were based on their molecular weight, however the new nomenclature uses sequential numbers based on which form (alpha or beta) of the gap junction is present. This gene encodes one of the connexin proteins. Mutations in this gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 29.15 kDa
• AA Sequence: GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GJB6 gap junction protein, beta 6, 30kDa [ Homo sapiens ]
• Official Symbol: GJB6
• Synonyms: GJB6; gap junction protein, beta 6, 30kDa; DFNA3, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, gap junction protein, beta 6, gap junction protein, beta 6 (connexin 30); gap junction beta-6 protein; connexin 30; CX30; EDH; HED; connexin-30; gap junction protein, beta 6 (connexin 30); ectodermal dysplasia 2, hidrotic (Clouston syndrome); ED2; DFNA3; DFNA3B; DFNB1B
• Gene ID: 10804
• mRNA Refseq: NM_001110219
• Protein Refseq: NP_001103689
• MIM: 604418
• UniProt ID: O95452