Recombinant Human GJD2 Protein, GST-tagged
| Cat.No. : | GJD2-2146H |
| Product Overview : | Human CX36 partial ORF ( NP_065711.1, 99 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion. [provided by RefSeq, Oct 2012] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GJD2 gap junction protein, delta 2, 36kDa [ Homo sapiens ] |
| Official Symbol | GJD2 |
| Synonyms | GJD2; gap junction protein, delta 2, 36kDa; gap junction protein, alpha 9, 36kDa , GJA9; gap junction delta-2 protein; connexin 36; CX36; connexin-36; gap junction alpha-9 protein; GJA9; MGC138315; MGC138319; |
| Gene ID | 57369 |
| mRNA Refseq | NM_020660 |
| Protein Refseq | NP_065711 |
| MIM | 607058 |
| UniProt ID | Q9UKL4 |
| ◆ Recombinant Proteins | ||
| GJD2-2213R | Recombinant Rat GJD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GJD2-2146H | Recombinant Human GJD2 Protein, GST-tagged | +Inquiry |
| GJD2-6151C | Recombinant Chicken GJD2 | +Inquiry |
| GJD2-012B | Recombinant Bovine GJD2 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
| GJD2-2557R | Recombinant Rat GJD2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJD2 Products
Required fields are marked with *
My Review for All GJD2 Products
Required fields are marked with *
