Recombinant Human GJD2 Protein, GST-tagged

Cat.No. : GJD2-2146H
Product Overview : Human CX36 partial ORF ( NP_065711.1, 99 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion. [provided by RefSeq, Oct 2012]
Molecular Mass : 36.63 kDa
AA Sequence : HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GJD2 gap junction protein, delta 2, 36kDa [ Homo sapiens ]
Official Symbol GJD2
Synonyms GJD2; gap junction protein, delta 2, 36kDa; gap junction protein, alpha 9, 36kDa , GJA9; gap junction delta-2 protein; connexin 36; CX36; connexin-36; gap junction alpha-9 protein; GJA9; MGC138315; MGC138319;
Gene ID 57369
mRNA Refseq NM_020660
Protein Refseq NP_065711
MIM 607058
UniProt ID Q9UKL4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GJD2 Products

Required fields are marked with *

My Review for All GJD2 Products

Required fields are marked with *

0
cart-icon