Recombinant Human GLB1L3 protein, His-tagged
Cat.No. : | GLB1L3-7754H |
Product Overview : | Recombinant Human GLB1L3 protein(1-90 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-90 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GLB1L3 galactosidase, beta 1-like 3 [ Homo sapiens ] |
Official Symbol | GLB1L3 |
Synonyms | GLB1L3; galactosidase, beta 1-like 3; beta-galactosidase-1-like protein 3; FLJ90231; galactosidase, beta 1 like 3; |
Gene ID | 112937 |
mRNA Refseq | NM_001080407 |
Protein Refseq | NP_001073876 |
UniProt ID | Q8NCI6 |
◆ Recombinant Proteins | ||
GLB1L3-6394M | Recombinant Mouse GLB1L3 Protein | +Inquiry |
GLB1L3-7754H | Recombinant Human GLB1L3 protein, His-tagged | +Inquiry |
GLB1L3-5285HF | Recombinant Full Length Human GLB1L3 Protein, GST-tagged | +Inquiry |
GLB1L3-3589M | Recombinant Mouse GLB1L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLB1L3-4948H | Recombinant Human GLB1L3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLB1L3-653HCL | Recombinant Human GLB1L3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLB1L3 Products
Required fields are marked with *
My Review for All GLB1L3 Products
Required fields are marked with *