Recombinant Human GLDN Protein
| Cat.No. : | GLDN-4951H |
| Product Overview : | Human GLDN full-length ORF (ADR83005.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in this gene cause a form of lethal congenital contracture syndrome in human patients. Autoantibodies to the encoded protein have been identified in sera form patients with multifocal motor neuropathy. [provided by RefSeq, May 2017] |
| Form : | Liquid |
| Molecular Mass : | 47 kDa |
| AA Sequence : | MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPNMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFANSKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDMRVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQ |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GLDN gliomedin [ Homo sapiens ] |
| Official Symbol | GLDN |
| Synonyms | GLDN; gliomedin; collomin, COLM; CLOM; colmedin; CRG L2; UNC 112; collomin; COLM; CRGL2; CRG-L2; UNC-112; FLJ23917; |
| Gene ID | 342035 |
| mRNA Refseq | NM_181789 |
| Protein Refseq | NP_861454 |
| MIM | 608603 |
| UniProt ID | Q6ZMI3 |
| ◆ Recombinant Proteins | ||
| GLDN-734H | Recombinant Human GLDN protein(Met1-Gln427), hFc-tagged | +Inquiry |
| GLDN-985H | Recombinant Human GLDN Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLDN-4951H | Recombinant Human GLDN Protein | +Inquiry |
| GLDN-5024Z | Recombinant Zebrafish GLDN | +Inquiry |
| GLDN-2560R | Recombinant Rat GLDN Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLDN Products
Required fields are marked with *
My Review for All GLDN Products
Required fields are marked with *
